Structure of PDB 8evs Chain AV

Receptor sequence
>8evsAV (length=136) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPA
ASLGDMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGV
IANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV
3D structure
PDB8evs Regulation of translation by ribosomal RNA pseudouridylation.
ChainAV
Resolution2.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AV G8 T9 K10 F11 R12 S14 G16 P18 A21 I22 I37 V39 K40 G41 S44 R45 L46 N47 R48 L49 M59 T61 K63 K71 V73 A82 K83 F92 G7 T8 K9 F10 R11 S13 G15 P17 A20 I21 I36 V38 K39 G40 S43 R44 L45 N46 R47 L48 M58 T60 K62 K70 V72 A81 K82 F91
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8evs, PDBe:8evs, PDBj:8evs
PDBsum8evs
PubMed37595043
UniProtP0CX41|RL23A_YEAST Large ribosomal subunit protein uL14A (Gene Name=RPL23A)

[Back to BioLiP]