Structure of PDB 4v8g Chain AV

Receptor sequence
>4v8gAV (length=53) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRV
VMA
3D structure
PDB4v8g How hibernation factors RMF, HPF, and YfiA turn off protein synthesis.
ChainAV
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AV R3 R15 Y31 Q32 Q39 R1 R13 Y29 Q30 Q37
Gene Ontology
Molecular Function
GO:0019843 rRNA binding
GO:0043022 ribosome binding
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006417 regulation of translation
GO:0022611 dormancy process
GO:0032055 negative regulation of translation in response to stress
GO:0033554 cellular response to stress
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8g, PDBe:4v8g, PDBj:4v8g
PDBsum4v8g
PubMed22605777
UniProtP0AFW2|RMF_ECOLI Ribosome modulation factor (Gene Name=rmf)

[Back to BioLiP]