Structure of PDB 4v6r Chain AV

Receptor sequence

>4v6rAV (length=91) Species: 562 (Escherichia coli) [Search protein sequence]

PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAV
HNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK

3D structure

PDB

4v6r Structural characterization of mRNA-tRNA translocation intermediates.

Chain

Resolution

11.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	AV	P1 R2 S3 L4 K5 K6 F9 D11 L12 H13 K16 K17 K20 W33 R35 R36 S37 G53 R54 K69 G71 E72 T76 R77 T78 R80 G81 H82 A84 K86	P1 R2 S3 L4 K5 K6 F9 D11 L12 H13 K16 K17 K20 W33 R35 R36 S37 G53 R54 K69 G71 E72 T76 R77 T78 R80 G81 H82 A84 K86
BS02	rna	AV	K89 K90 K91	K89 K90 K91
BS03	rna	AV	V57 P58	V57 P58

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6r, PDBe:4v6r, PDBj:4v6r
PDBsum	4v6r
PubMed	22467828
UniProt	P0A7U3\|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)