Structure of PDB 4v65 Chain AV

Receptor sequence

>4v65AV (length=129) Species: 562 (Escherichia coli) [Search protein sequence]

SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKV
EGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGI
AVVSTSKGVMTDRAARQAGLGGEIICYVA

3D structure

PDB

4v65 The Structure of the E. coli Ribosome Before and After Accommodation: Implications for Proofreading

Chain

Resolution

9.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AV	S1 M2 Q3 D4 D8 T11 R12 R14 N15 A18 A19 N20 K21 S29 K30 G67 K68 Q75 R76 R79 L82 Y85 R87 K88 T105 S106 K107 G108 G119 G121 E123	S1 M2 Q3 D4 D8 T11 R12 R14 N15 A18 A19 N20 K21 S29 K30 G67 K68 Q75 R76 R79 L82 Y85 R87 K88 T105 S106 K107 G108 G119 G121 E123

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v65, PDBe:4v65, PDBj:4v65
PDBsum	4v65
PubMed
UniProt	Q3YWV3\|RS8_SHISS Small ribosomal subunit protein uS8 (Gene Name=rpsH)