Structure of PDB 9cai Chain AU

Receptor sequence
>9caiAU (length=100) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
HRIRLTLTSQNVKPLEKVCAQLIDGAKNEHLIVKGPIRMPTKVLRITTRK
TPCGEGSKTWDRFQMRIHKRLINLHAPAEVLRQITSISIEPGVDIEVTRA
3D structure
PDB9cai High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.
ChainAU
Resolution2.59 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AU R18 R20 V28 E32 K50 G51 P52 I53 R54 M55 P56 K58 T63 R65 K66 P68 C69 G70 E71 G72 S73 K74 T75 W76 R78 R82 K85 R86 N89 R2 R4 V12 E16 K34 G35 P36 I37 R38 M39 P40 K42 T47 R49 K50 P52 C53 G54 E55 G56 S57 K58 T59 W60 R62 R66 K69 R70 N73
External links