Structure of PDB 8fmw Chain AU

Receptor sequence
>8fmwAU (length=115) Species: 224326 (Borreliella burgdorferi B31) [Search protein sequence]
LVNRRYTAKGKNLPSSPKKVRPIADNIRGESYIKAIAVLCSMPNKGAKLL
EKVVKSAASNAMYHNKNLSEDMIFVKTVMVDDGRRRKKIWPRARGRADRL
VNRNCHIFVEVDEKK
3D structure
PDB8fmw The structure of a hibernating ribosome in a Lyme disease pathogen.
ChainAU
Resolution2.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AU R5 R6 T8 K10 K12 S17 K19 K20 R22 N45 K46 K53 S60 N61 H65 M80 D82 D83 R86 W91 P92 R93 A94 R95 G96 R97 A98 D99 L101 V102 N103 R4 R5 T7 K9 K11 S16 K18 K19 R21 N44 K45 K52 S59 N60 H64 M79 D81 D82 R85 W90 P91 R92 A93 R94 G95 R96 A97 D98 L100 V101 N102
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fmw, PDBe:8fmw, PDBj:8fmw
PDBsum8fmw
PubMed37907464
UniProtP94272|RL22_BORBU Large ribosomal subunit protein uL22 (Gene Name=rplV)

[Back to BioLiP]