Structure of PDB 6p5k Chain AU

Receptor sequence
>6p5kAU (length=99) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
QVLKFTLDCTHPVEDRIMDEANSEQFLQERIKVNGKARNLGGGAVTIERS
KSKITVTSEVPFSKRYLKYLTKKYLKKNNLHDWLRVVANSKESYELRYF
3D structure
PDB6p5k The Israeli acute paralysis virus IRES captures host ribosomes by mimicking a ribosomal state with hybrid tRNAs.
ChainAU
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AU K48 N50 G51 S79 K80 R81 Y82 K84 Y85 K88 K89 K92 H97 R101 A104 K107 R113 K32 N34 G35 S63 K64 R65 Y66 K68 Y69 K72 K73 K76 H81 R85 A88 K91 R97
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008201 heparin binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6p5k, PDBe:6p5k, PDBj:6p5k
PDBsum6p5k
PubMed31609474
UniProtG1TSG1|RL22_RABIT Large ribosomal subunit protein eL22 (Gene Name=RPL22)

[Back to BioLiP]