Structure of PDB 6eri Chain AU

Receptor sequence
>6eriAU (length=127) Species: 3562 (Spinacia oleracea) [Search protein sequence]
IKRWERKDCKPNSLPKLHKMHVKVGDTVKVISGGEKGKIGEISKIHKHNS
TVIIKDLNLKTKHVKSKEEGEQGQIIKIEAAIHSSNVMLYSKEQEVASRV
GHKILEDGRKVRYLIKTGEIVDTPDRW
3D structure
PDB6eri Structure of the chloroplast ribosome with chl-RRF and hibernation-promoting factor.
ChainAU
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AU K50 R51 W52 R54 K58 N60 S61 K67 H69 K71 G81 G82 K108 T109 K110 H111 Q120 G121 Q122 I123 H131 S133 N134 R147 H150 K158 W175 K2 R3 W4 R6 K10 N12 S13 K19 H21 K23 G33 G34 K60 T61 K62 H63 Q72 G73 Q74 I75 H83 S85 N86 R99 H102 K110 W127
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6eri, PDBe:6eri, PDBj:6eri
PDBsum6eri
PubMed29610536
UniProtP27683|RK24_SPIOL Large ribosomal subunit protein uL24c (Gene Name=RPL24)

[Back to BioLiP]