Structure of PDB 4v8c Chain AU

Receptor sequence
>4v8cAU (length=102) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
CG
3D structure
PDB4v8c A new understanding of the decoding principle on the ribosome.
ChainAU
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AU R2 K4 H6 K8 K9 S17 G18 K19 V30 Y35 I44 K46 K47 V49 V51 G59 F60 H68 S70 K71 R73 P82 R84 V85 R1 K3 H5 K7 K8 S16 G17 K18 V29 Y34 I43 K45 K46 V48 V50 G58 F59 H67 S69 K70 R72 P81 R83 V84
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8c, PDBe:4v8c, PDBj:4v8c
PDBsum4v8c
PubMed22437501
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]