Structure of PDB 4v7j Chain AU

Receptor sequence

>4v7jAU (length=117) Species: 300852 (Thermus thermophilus HB8)

PRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRK
RRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVR
EPQVFAELVERAKAAQG

3D structure

• PDB: 4v7j The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
• Chain: AU
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AU	P2 R3 A4 K5 T6 G7 V8 V9 R10 R11 R12 K13 H14 K15 K16 K19 G23 Y24 W25 G26 L27 R28 S31 R33 K34 R36 E37 A42 Y45 A46 Y47 H49 R50 K51 R52 R53 K54 R55 F57 R58 R59 W61 I62 R70 N75 Y76 S77 H81 R92 K93 N94	P1 R2 A3 K4 T5 G6 V7 V8 R9 R10 R11 K12 H13 K14 K15 K18 G22 Y23 W24 G25 L26 R27 S30 R32 K33 R35 E36 A41 Y44 A45 Y46 H48 R49 K50 R51 R52 K53 R54 F56 R57 R58 W60 I61 R69 N74 Y75 S76 H80 R91 K92 N93

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7j, PDBe:4v7j, PDBj:4v7j
• PDBsum: 4v7j
• PubMed: 20005802
• UniProt: P60491|RL20_THET8 Large ribosomal subunit protein bL20 (Gene Name=rplT)