Structure of PDB 4v6q Chain AU

Receptor sequence

>4v6qAU (length=74) Species: 562 (Escherichia coli) [Search protein sequence]

ARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKY
QRQLARAIKRARYLSLLPYTDRHQ

3D structure

PDB

4v6q Structural characterization of mRNA-tRNA translocation intermediates.

Chain

Resolution

11.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AU	R2 F4 R5 R6 R7 F9 C10 R11 F12 K37 I38 S41 R42 T46 R47 A48 K49 Y50 Q51 R52 Q53 A55 R56 K59 R60 R62 Y63 Y69 H73	R2 F4 R5 R6 R7 F9 C10 R11 F12 K37 I38 S41 R42 T46 R47 A48 K49 Y50 Q51 R52 Q53 A55 R56 K59 R60 R62 Y63 Y69 H73
BS02	rna	AU	I25 K29 N30 I32 E34 I43 Q74	I25 K29 N30 I32 E34 I43 Q74

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0048027	mRNA 5'-UTR binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6q, PDBe:4v6q, PDBj:4v6q
PDBsum	4v6q
PubMed	22467828
UniProt	P0A7T7\|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)