Structure of PDB 4v6o Chain AU

Receptor sequence

>4v6oAU (length=74) Species: 562 (Escherichia coli)

ARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKY
QRQLARAIKRARYLSLLPYTDRHQ

3D structure

• PDB: 4v6o Structural characterization of mRNA-tRNA translocation intermediates.
• Chain: AU
• Resolution: 14.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AU	R2 Y3 F4 R5 R6 R7 C10 R11 F12 I38 S41 R42 G45 T46 R47 A48 K49 Q51 R52 Q53 A55 R56 K59 R60 Y63 Y69 T70 R72	R2 Y3 F4 R5 R6 R7 C10 R11 F12 I38 S41 R42 G45 T46 R47 A48 K49 Q51 R52 Q53 A55 R56 K59 R60 Y63 Y69 T70 R72
BS02	rna	AU	I25 K29 I32 T33 E34 G36 R42 I43 P68 Q74	I25 K29 I32 T33 E34 G36 R42 I43 P68 Q74

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0048027 mRNA 5'-UTR binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
• PDBsum: 4v6o
• PubMed: 22467828
• UniProt: P0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)