Structure of PDB 4v65 Chain AU

Receptor sequence
>4v65AU (length=150) Species: 562 (Escherichia coli) [Search protein sequence]
RRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQ
RSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
WIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFA
3D structure
PDB4v65 The Structure of the E. coli Ribosome Before and After Accommodation: Implications for Proofreading
ChainAU
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AU T83 K135 D139 R142 M143 T82 K134 D138 R141 M142
BS02 rna AU R2 R3 R4 V5 G7 R9 L29 M30 V31 D32 G33 K34 K35 T37 E73 K75 S76 R78 V79 R94 R101 R108 M115 R118 R1 R2 R3 V4 G6 R8 L28 M29 V30 D31 G32 K33 K34 T36 E72 K74 S75 R77 V78 R93 R100 R107 M114 R117
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v65, PDBe:4v65, PDBj:4v65
PDBsum4v65
PubMed
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]