Structure of PDB 4v4p Chain AU

Receptor sequence
>4v4pAU (length=110) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGVRVNAGDTVEVLRG
DFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDL
EDEKREARLE
3D structure
PDB4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
ChainAU
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AU K2 Q3 K6 Q7 R8 P15 L16 H17 E18 H20 K21 Q22 R24 R32 R52 G53 D54 V65 L67 D68 L79 T82 D83 P90 D92 S94 K107 R111 K2 Q3 K6 Q7 R8 P15 L16 H17 E18 H20 K21 Q22 R24 R32 R49 G50 D51 V62 L64 D65 L76 T79 D80 P87 D89 S91 K104 R108
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Mar 9 09:13:53 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4p', asym_id = 'AU', title = 'Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4p', asym_id='AU', title='Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015934', uniprot = '', pdbid = '4v4p', asym_id = 'AU'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015934', uniprot='', pdbid='4v4p', asym_id='AU')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>