Structure of PDB 3jbp Chain AU

Receptor sequence

>3jbpAU (length=180) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

IDNSLNTNIHQYHIVGRAIPTAKDKNPNVYRMCIFAKNDTNAKSRFWYFM
KKINKLKKSNGELLACEQIKERFPLRVKNYGVLLRYDSRTGTHNMYKEFR
DTTKEGAIAQLYSEMAGRHRARASSINIIRISEISSSLVRRPHIKQLLKR
RLRFPALHLPTLQKEYRKKFASKRPSTYRM

3D structure

PDB

3jbp Dynamical features of the Plasmodium falciparum ribosome during translation.

Chain

Resolution

6.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AU	N12 K41 R76 F77 R80 R93 T94 M99 Y100 K101 S117 A120 R122 H123 R124 R126 E137 R145 R154 R155 R157 L161 L163 K168 Y170 R171 K172 S176 K177 R178 S180 T181 Y182 M184	N8 K37 R72 F73 R76 R89 T90 M95 Y96 K97 S113 A116 R118 H119 R120 R122 E133 R141 R150 R151 R153 L157 L159 K164 Y166 R167 K168 S172 K173 R174 S176 T177 Y178 M180
BS02	rna	AU	K27 R49 Y52 K56 K59 K61 K62 S63	K23 R45 Y48 K52 K55 K57 K58 S59

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jbp, PDBe:3jbp, PDBj:3jbp
PDBsum	3jbp
PubMed	26432834
UniProt	Q8IDS6

[Back to BioLiP]