Structure of PDB 9cai Chain AT

Receptor sequence

>9caiAT (length=140) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]

TRATSIKDVDQHEATKSIAHFLKKSGKVKVPEWSDLVKLGVNKELAPVDP
DWFYTRAASLARHLYFRPAGIGAFKKVYGGNKRRGVAPNHFQTSAGNCLR
KAVQQLEKIKWVEKHPDGKGRILSKQGRKDLDRIATSLRS

3D structure

PDB

9cai High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.

Chain

Resolution

2.59 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AT	T2 R3 T5 K8 Q12 H13 W34 V38 K39 L40 V42 K44 E45 L46 P48 V49 R57 S60 R63 H64 R68 G71 I72 A74 K77 V78 N82 K83 R84 R85 G86 V87 P89 N90 H91 F92 A96 G97 N98 R101 Q105 K120 R122 K126 K130 D133 T137 R140	T1 R2 T4 K7 Q11 H12 W33 V37 K38 L39 V41 K43 E44 L45 P47 V48 R56 S59 R62 H63 R67 G70 I71 A73 K76 V77 N81 K82 R83 R84 G85 V86 P88 N89 H90 F91 A95 G96 N97 R100 Q104 K119 R121 K125 K129 D132 T136 R139

External links

PDB	RCSB:9cai, PDBe:9cai, PDBj:9cai
PDBsum	9cai
PubMed	39209556
UniProt	O18650\|RS19_CAEEL Small ribosomal subunit protein eS19 (Gene Name=rps-19)