Structure of PDB 8ova Chain AT

Receptor sequence

>8ovaAT (length=129) Species: 5702 (Trypanosoma brucei brucei)

VFQKKKAEVTVRTSQFKVNKLLNRKQFVVEVNHPGWCGTVPAKLIRNRLA
SLYKVADENQISVFGFKTKFGGGKTTGFGLIYDDLAAMKRIEPNYRKARL
GMGKKKLPARKSVKERRNRNKKIRGKAKG

3D structure

• PDB: 8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: AT
• Resolution: 2.47 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AT	K5 K6 A8 R13 T14 S15 Q16 F17 K26 W37 C38 G39 T40 A43 Y54 F67 T69 K70 F71 G72 R91 Y96 R100 K105 K106 L108 R111 K112 K115 E116 R118 R125 G126 K127 G130	K4 K5 A7 R12 T13 S14 Q15 F16 K25 W36 C37 G38 T39 A42 Y53 F66 T68 K69 F70 G71 R90 Y95 R99 K104 K105 L107 R110 K111 K114 E115 R117 R124 G125 K126 G129

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0042301 phosphate ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ova, PDBe:8ova, PDBj:8ova
• PDBsum: 8ova
• PubMed: 37985661
• UniProt: Q38AM9