Structure of PDB 7o1c Chain AT

Receptor sequence
>7o1cAT (length=86) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAF
NEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB7o1c Structural basis for the tryptophan sensitivity of TnaC-mediated ribosome stalling.
ChainAT
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AT A2 N3 I4 K5 S6 A7 K9 R10 Q13 K16 R18 N21 S23 S26 R29 T30 K33 K34 Y36 Q55 D59 R60 K64 H68 K69 N70 K71 R74 K76 Q82 A1 N2 I3 K4 S5 A6 K8 R9 Q12 K15 R17 N20 S22 S25 R28 T29 K32 K33 Y35 Q54 D58 R59 K63 H67 K68 N69 K70 R73 K75 Q81
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o1c, PDBe:7o1c, PDBj:7o1c
PDBsum7o1c
PubMed34504068
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]