Structure of PDB 6xir Chain AT

Receptor sequence
>6xirAT (length=53) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFN
KFR
3D structure
PDB6xir Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.
ChainAT
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AT E4 W7 F8 H10 R12 Y14 K16 H27 I31 R32 Y34 R40 K54 F55 R56 E1 W4 F5 H7 R9 Y11 K13 H24 I28 R29 Y31 R37 K51 F52 R53
BS02 ZN AT V23 C39 C42 V20 C36 C39
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri May 9 21:39:46 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1472         else:
=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1474     
   1475     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6xir', asym_id = 'AT', title = 'Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6xir', asym_id='AT', title='Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.')
    840 
    841     if go:
=>  842         display_go(go,uniprot,pdbid,asym_id)
    843     return pubmed,uniprot
    844 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008270', uniprot = '', pdbid = '6xir', asym_id = 'AT'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008270', uniprot='', pdbid='6xir', asym_id='AT')
    481         '''.replace("$namespace_link",namespace_link
    482           ).replace("$namespace",namespace
=>  483           ).replace("$uniprot",u
    484         ))
    485         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>