Structure of PDB 6sv4 Chain AT

Receptor sequence
>6sv4AT (length=91) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGA
AGIWTCSCCKKTVAGGAYTVSTAAAATVRSTIRRLREMVEA
3D structure
PDB6sv4 RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.
ChainAT
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AT A2 R4 T5 K6 K7 V8 G9 I10 K13 Y14 G15 V16 R17 Y18 G19 S20 S21 H34 F41 C42 K44 K48 A51 Y69 A1 R3 T4 K5 K6 V7 G8 I9 K12 Y13 G14 V15 R16 Y17 G18 S19 S20 H33 F40 C41 K43 K47 A50 Y68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6sv4, PDBe:6sv4, PDBj:6sv4
PDBsum6sv4
PubMed32203490
UniProtP0CX25|RL43A_YEAST Large ribosomal subunit protein eL43A (Gene Name=RPL43A)

[Back to BioLiP]