Structure of PDB 4v8y Chain AT

Receptor sequence

>4v8yAT (length=143) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAE
GWFYKRAASVARHIYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSIN
RKVLQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEEDE

3D structure

PDB

4v8y Molecular architecture of a eukaryotic translational initiation complex.

Chain

Resolution

4.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AT	Q12 I15 Y33 K38 T39 S41 N43 E44 Q48 K56 R57 S60 R63 H64 R68 K69 K75 K78 L79 Y80 K84 S85 R86 G87 V88 R89 P90 Y91 H93 G98 S99 R102 K119 G121 R122	Q11 I14 Y32 K37 T38 S40 N42 E43 Q47 K55 R56 S59 R62 H63 R67 K68 K74 K77 L78 Y79 K83 S84 R85 G86 V87 R88 P89 Y90 H92 G97 S98 R101 K118 G120 R121

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000054	ribosomal subunit export from nucleus
GO:0006412	translation
GO:0042254	ribosome biogenesis
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v8y, PDBe:4v8y, PDBj:4v8y
PDBsum	4v8y
PubMed	24200810
UniProt	P07280\|RS19A_YEAST Small ribosomal subunit protein eS19A (Gene Name=RPS19A)