Structure of PDB 4v89 Chain AT

Receptor sequence
>4v89AT (length=85) Species: 562 (Escherichia coli) [Search protein sequence]
NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB4v89 Crystal structure of release factor RF3 trapped in the GTP state on a rotated conformation of the ribosome.
ChainAT
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AT N2 K4 K8 R9 R17 H19 N20 S22 R23 S25 M26 R28 T29 F30 K32 Q54 P55 D58 R59 K63 K68 N69 K70 A72 R73 K75 A76 Q81 N1 K3 K7 R8 R16 H18 N19 S21 R22 S24 M25 R27 T28 F29 K31 Q53 P54 D57 R58 K62 K67 N68 K69 A71 R72 K74 A75 Q80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v89, PDBe:4v89, PDBj:4v89
PDBsum4v89
PubMed22187675
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]