Structure of PDB 4v73 Chain AT

Receptor sequence
>4v73AT (length=85) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB4v73 Energy barriers and driving forces in tRNA translocation through the ribosome.
ChainAT
Resolution15.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AT K4 S5 A6 K7 R9 Q12 S13 K18 H19 S22 R24 M26 R28 Q54 D58 R59 A61 A62 H67 K68 N69 K70 R73 A76 K3 S4 A5 K6 R8 Q11 S12 K17 H18 S21 R23 M25 R27 Q53 D57 R58 A60 A61 H66 K67 N68 K69 R72 A75
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v73, PDBe:4v73, PDBj:4v73
PDBsum4v73
PubMed24186064
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]