Structure of PDB 4v6q Chain AT

Receptor sequence

>4v6qAT (length=83) Species: 562 (Escherichia coli) [Search protein sequence]

TDKIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENN
ECGIGDVVEIRECRPLSKTKSWTLVRVVEKAVL

3D structure

PDB

4v6q Structural characterization of mRNA-tRNA translocation intermediates.

Chain

Resolution

11.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AT	D2 K3 I4 R5 T6 S13 M16 E17 K18 S19 E25 R26 F27 I32 F36 K38 R39 T40 T41 K42 L43 H44 E62 C63 R64 P65 L66 S67 K68 T69 K70 W72 L83	D2 K3 I4 R5 T6 S13 M16 E17 K18 S19 E25 R26 F27 I32 F36 K38 R39 T40 T41 K42 L43 H44 E62 C63 R64 P65 L66 S67 K68 T69 K70 W72 L83

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0046677	response to antibiotic

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6q, PDBe:4v6q, PDBj:4v6q
PDBsum	4v6q
PubMed	22467828
UniProt	P0AG63\|RS17_ECOLI Small ribosomal subunit protein uS17 (Gene Name=rpsQ)