Structure of PDB 4v6p Chain AT

Receptor sequence

>4v6pAT (length=83) Species: 562 (Escherichia coli)

TDKIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENN
ECGIGDVVEIRECRPLSKTKSWTLVRVVEKAVL

3D structure

• PDB: 4v6p Structural characterization of mRNA-tRNA translocation intermediates.
• Chain: AT
• Resolution: 13.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AT	D2 K3 I4 R5 T6 Q8 R10 S13 K15 M16 E17 K18 E25 R26 F27 P31 I32 Y33 G34 K38 R39 T40 T41 K42 L43 H44 E62 C63 R64 P65 S67 K68 T69 K70 W72 E79 V82 L83	D2 K3 I4 R5 T6 Q8 R10 S13 K15 M16 E17 K18 E25 R26 F27 P31 I32 Y33 G34 K38 R39 T40 T41 K42 L43 H44 E62 C63 R64 P65 S67 K68 T69 K70 W72 E79 V82 L83

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6p, PDBe:4v6p, PDBj:4v6p
• PDBsum: 4v6p
• PubMed: 22467828
• UniProt: P0AG63|RS17_ECOLI Small ribosomal subunit protein uS17 (Gene Name=rpsQ)