Structure of PDB 4v6m Chain AT

Receptor sequence

>4v6mAT (length=86) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAF
NEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA

3D structure

PDB

4v6m Cryo-EM structure of the ribosome-SecYE complex in the membrane environment.

Chain

Resolution

7.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AT	A1 N2 K4 K7 K8 R9 Q12 K15 R17 H19 N20 S22 R23 R24 S25 M26 R28 Q54 P55 D58 R59 A62 K63 H67 K68 N69 K70 A72 R73 H74 K75 A76 N77 T79 K84	A1 N2 K4 K7 K8 R9 Q12 K15 R17 H19 N20 S22 R23 R24 S25 M26 R28 Q54 P55 D58 R59 A62 K63 H67 K68 N69 K70 A72 R73 H74 K75 A76 N77 T79 K84

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008073	ornithine decarboxylase inhibitor activity
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6m, PDBe:4v6m, PDBj:4v6m
PDBsum	4v6m
PubMed	21499241
UniProt	P0A7U7\|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)