Structure of PDB 4v65 Chain AT

Receptor sequence
>4v65AT (length=100) Species: 562 (Escherichia coli) [Search protein sequence]
MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYP
INKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEAS
3D structure
PDB4v65 The Structure of the E. coli Ribosome Before and After Accommodation: Implications for Proofreading
ChainAT
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AT R2 Y4 K53 Q68 R79 R86 R91 K93 R2 Y4 K53 Q68 R79 R86 R91 K93
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v65, PDBe:4v65, PDBj:4v65
PDBsum4v65
PubMed
UniProtP02358|RS6_ECOLI Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]