Structure of PDB 4v5m Chain AT

Receptor sequence

>4v5mAT (length=99) Species: 300852 (Thermus thermophilus HB8)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA

3D structure

• PDB: 4v5m Head Swivel on the Ribosome Facilitates Translocation by Means of Intra-Subunit tRNA Hybrid Sites.
• Chain: AT
• Resolution: 7.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AT	L10 K14 R15 R17 S19 K21 R22 R23 K29 S31 K34 T35 K38 K39 R57 E60 S61 K65 K68 S70 K74 A78 R79 K81 S82 R83 M85 R89 G102 G103 S105 A106	L3 K7 R8 R10 S12 K14 R15 R16 K22 S24 K27 T28 K31 K32 R50 E53 S54 K58 K61 S63 K67 A71 R72 K74 S75 R76 M78 R82 G95 G96 S98 A99

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5m, PDBe:4v5m, PDBj:4v5m
• PDBsum: 4v5m
• PubMed: 21124459
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)