Structure of PDB 4v4p Chain AT

Receptor sequence

>4v4pAT (length=76) Species: 300852 (Thermus thermophilus HB8)

SWDVIKHPHVTEKAMNDMDFNKLQFAVDDRASKGEVADAVEEQYDVTVEQ
VNTQNTMDGEKKAVVRLSEDDDQEVA

3D structure

• PDB: 4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
• Chain: AT
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AT	W2 T11 E12 K13 S33 K34 E36 D39 E42 E43 T48 N53 T54 Q55 T57 M58 D59 G60 K62 K63 R67	W2 T11 E12 K13 S32 K33 E35 D38 E41 E42 T47 N52 T53 Q54 T56 M57 D58 G59 K61 K62 R66

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Mar 9 09:47:23 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4p', asym_id = 'AT', title = 'Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4p', asym_id='AT', title='Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v4p', asym_id = 'AT'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v4p', asym_id='AT')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>