Structure of PDB 4v4n Chain AT

Receptor sequence
>4v4nAT (length=84) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence]
PYKVIIRPVVTEKAISLIEKENKLTFIVDRRATKQDIKRAVEEIFNVKVE
KVNTLITPRGEKKAYVKLKPEYSASEVAARLGLF
3D structure
PDB4v4n Structure of the SecY channel during initiation of protein translocation.
ChainAT
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AT Y4 K15 E23 R32 R33 T35 K36 K53 N55 T56 L57 I58 R61 Y67 Y2 K13 E21 R30 R31 T33 K34 K51 N53 T54 L55 I56 R59 Y65
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Mar 9 09:01:27 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4n', asym_id = 'AT', title = 'Structure of the SecY channel during initiation of protein translocation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4n', asym_id='AT', title='Structure of the SecY channel during initiation of protein translocation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v4n', asym_id = 'AT'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v4n', asym_id='AT')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>