Structure of PDB 8hkz Chain AS9P

Receptor sequence

>8hkzAS9P (length=136) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

QAEQNFMITYARRKSARASCYIKPGNGKVFVNDIPIEIIPIEVVRYKIME
PLVLAGDKITSSIEARIYTQGGGIMGQADAARMALARALVKFTNSKELVE
IYKSYDRTMLAGDPRQTESEKWMRYSARRWRQKAYR

3D structure

PDB

8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.

Chain

AS9P

Resolution

4.78 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS9P	Q3 A4 E5 Q6 Y12 R14 S17 R19 P42 I43 Q72 G73 G74 G75 I76 M77 R109 R117 Q118 T119 E120 S121 E122 K123 W124 M125 R130 R131 W132 R133 Q134 K135 Y137 R138	Q1 A2 E3 Q4 Y10 R12 S15 R17 P40 I41 Q70 G71 G72 G73 I74 M75 R107 R115 Q116 T117 E118 S119 E120 K121 W122 M123 R128 R129 W130 R131 Q132 K133 Y135 R136

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum	8hkz
PubMed	37604686
UniProt	P39468\|RS9_SULAC Small ribosomal subunit protein uS9 (Gene Name=rps9)