Structure of PDB 8wq4 Chain AS8P

Receptor sequence
>8wq4AS8P (length=130) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
INPLANALATLYNNEMRRNKQALITPASKLIISVLRVMQKEGYIGEFEYI
DDGRAGKIIVQLLGRINKCGPISPRYPLDYNGLLRLPDYIRKYLPSKEIG
IIIISTPKGVMSHRDGIREKIGGVTLGYVY
3D structure
PDB8wq4 Structural basis of translation inhibition by a valine tRNA-derived fragment
ChainAS8P
Resolution4.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS8P I4 N9 T13 N16 R20 R21 T28 S31 K32 L33 G56 R57 P74 L81 D82 Y83 Y92 R94 P110 K111 I124 G125 I1 N6 T10 N13 R17 R18 T25 S28 K29 L30 G53 R54 P71 L78 D79 Y80 Y89 R91 P107 K108 I121 G122
BS02 UNK AS8P K23 L66 G67 K20 L63 G64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wq4, PDBe:8wq4, PDBj:8wq4
PDBsum8wq4
PubMed38599770
UniProtO05636|RS8_SULAC Small ribosomal subunit protein uS8 (Gene Name=rps8)

[Back to BioLiP]