Structure of PDB 8wq2 Chain AS8P

Receptor sequence
>8wq2AS8P (length=130) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
INPLANALATLYNNEMRRNKQALITPASKLIISVLRVMQKEGYIGEFEYI
DDGRAGKIIVQLLGRINKCGPISPRYPLDYNGLLRLPDYIRKYLPSKEIG
IIIISTPKGVMSHRDGIREKIGGVTLGYVY
3D structure
PDB8wq2 Structural basis of translation inhibition by a valine tRNA-derived fragment
ChainAS8P
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS8P I4 P6 N9 T13 N16 N17 R20 S31 K32 G56 R57 A58 P74 S76 D82 Y83 Y92 R94 S108 P110 G125 I1 P3 N6 T10 N13 N14 R17 S28 K29 G53 R54 A55 P71 S73 D79 Y80 Y89 R91 S105 P107 G122
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wq2, PDBe:8wq2, PDBj:8wq2
PDBsum8wq2
PubMed38599770
UniProtO05636|RS8_SULAC Small ribosomal subunit protein uS8 (Gene Name=rps8)

[Back to BioLiP]