Structure of PDB 8hl5 Chain AS8P

Receptor sequence
>8hl5AS8P (length=130) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
INPLANALATLYNNEMRRNKQALITPASKLIISVLRVMQKEGYIGEFEYI
DDGRAGKIIVQLLGRINKCGPISPRYPLDYNGLLRLPDYIRKYLPSKEIG
IIIISTPKGVMSHRDGIREKIGGVTLGYVY
3D structure
PDB8hl5 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
ChainAS8P
Resolution5.72 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS8P I4 N5 N9 T13 N16 R20 L26 T28 S31 K32 L33 R57 P80 L81 D82 Y83 Y92 R94 S108 T109 P110 G112 G125 I1 N2 N6 T10 N13 R17 L23 T25 S28 K29 L30 R54 P77 L78 D79 Y80 Y89 R91 S105 T106 P107 G109 G122
BS02 UNK AS8P R21 K23 R18 K20
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hl5, PDBe:8hl5, PDBj:8hl5
PDBsum8hl5
PubMed37604686
UniProtO05636|RS8_SULAC Small ribosomal subunit protein uS8 (Gene Name=rps8)

[Back to BioLiP]