Structure of PDB 8hl4 Chain AS8P

Receptor sequence
>8hl4AS8P (length=130) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
INPLANALATLYNNEMRRNKQALITPASKLIISVLRVMQKEGYIGEFEYI
DDGRAGKIIVQLLGRINKCGPISPRYPLDYNGLLRLPDYIRKYLPSKEIG
IIIISTPKGVMSHRDGIREKIGGVTLGYVY
3D structure
PDB8hl4 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
ChainAS8P
Resolution4.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS8P I4 P6 N9 T13 Y15 N16 R20 S31 K32 R57 S76 P80 L81 D82 Y83 Y92 R94 S108 T109 P110 K123 I124 G125 I1 P3 N6 T10 Y12 N13 R17 S28 K29 R54 S73 P77 L78 D79 Y80 Y89 R91 S105 T106 P107 K120 I121 G122
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hl4, PDBe:8hl4, PDBj:8hl4
PDBsum8hl4
PubMed37604686
UniProtO05636|RS8_SULAC Small ribosomal subunit protein uS8 (Gene Name=rps8)

[Back to BioLiP]