Structure of PDB 8hkz Chain AS8P

Receptor sequence
>8hkzAS8P (length=130) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
INPLANALATLYNNEMRRNKQALITPASKLIISVLRVMQKEGYIGEFEYI
DDGRAGKIIVQLLGRINKCGPISPRYPLDYNGLLRLPDYIRKYLPSKEIG
IIIISTPKGVMSHRDGIREKIGGVTLGYVY
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainAS8P
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS8P I4 P6 A8 T13 N16 R20 S31 K32 L33 R57 A58 S76 R78 P80 L81 D82 P90 R94 S108 T109 P110 G112 V127 I1 P3 A5 T10 N13 R17 S28 K29 L30 R54 A55 S73 R75 P77 L78 D79 P87 R91 S105 T106 P107 G109 V124
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtO05636|RS8_SULAC Small ribosomal subunit protein uS8 (Gene Name=rps8)

[Back to BioLiP]