Structure of PDB 8wq4 Chain AS8E

Receptor sequence

>8wq4AS8E (length=126) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

SYYQGNDSRKITGGQKGKNRDKRKYELGSPPTETKISDKDIKEKDRVAGG
NFKLRLRYASYANVYDPQSKTAKKVKIISVLESPANREYARRGIIVKGTL
IQTELGKAKVTSRPGQDGIINALLLR

3D structure

PDB

8wq4 Structural basis of translation inhibition by a valine tRNA-derived fragment

Chain

AS8E

Resolution

4.53 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS8E	Q5 G6 D8 R10 T13 G15 Q16 G18 K19 R21 R24 K25 Y26 L28 S30 K43 K45 R47 V48 A49 L55 N64 Y66 K71 A73 K75 A86 N87 K98 T112 S113 R114 Q117 D118 I120 N122	Q4 G5 D7 R9 T12 G14 Q15 G17 K18 R20 R23 K24 Y25 L27 S29 K42 K44 R46 V47 A48 L54 N63 Y65 K70 A72 K74 A85 N86 K97 T111 S112 R113 Q116 D117 I119 N121

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8wq4, PDBe:8wq4, PDBj:8wq4
PDBsum	8wq4
PubMed	38599770
UniProt	Q4JAP5\|RS8E_SULAC Small ribosomal subunit protein eS8 (Gene Name=rps8e)