Structure of PDB 8wq2 Chain AS7P

Receptor sequence
>8wq2AS7P (length=193) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
ENIEVSNLNVKVFGKWDTKVEVRDPSLKKYIDLMSIYLPHTGGRHEHRRF
GKSRIPIVERLINNLMRPGRNKGKKMLAYNIVKTTFDIIAVKTGQNPIQV
LVRAIENAAPREEVTRIMYGGIVYYVAVDVAPQRRVDLALRHLVTGASEA
SFNNPKPIEEALAEEIIAAANNDNKSVAIRKKEEIERIALSSR
3D structure
PDB8wq2 Structural basis of translation inhibition by a valine tRNA-derived fragment
ChainAS7P
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS7P E3 H47 E48 R51 K54 N65 L67 P70 G71 R72 N73 K74 G75 K76 K77 L79 D139 R143 F154 N155 P157 E1 H45 E46 R49 K52 N63 L65 P68 G69 R70 N71 K72 G73 K74 K75 L77 D137 R141 F152 N153 P155
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wq2, PDBe:8wq2, PDBj:8wq2
PDBsum8wq2
PubMed38599770
UniProtP17198|RS7_SULAC Small ribosomal subunit protein uS7 (Gene Name=rps7)

[Back to BioLiP]