Structure of PDB 8hl3 Chain AS7P

Receptor sequence
>8hl3AS7P (length=193) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
ENIEVSNLNVKVFGKWDTKVEVRDPSLKKYIDLMSIYLPHTGGRHEHRRF
GKSRIPIVERLINNLMRPGRNKGKKMLAYNIVKTTFDIIAVKTGQNPIQV
LVRAIENAAPREEVTRIMYGGIVYYVAVDVAPQRRVDLALRHLVTGASEA
SFNNPKPIEEALAEEIIAAANNDNKSVAIRKKEEIERIALSSR
3D structure
PDB8hl3 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
ChainAS7P
Resolution4.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS7P E48 R50 R51 K54 N65 R69 P70 R72 N73 K74 K77 M78 L79 I83 R118 D139 R143 S153 F154 N155 N156 P157 P159 I160 E161 E46 R48 R49 K52 N63 R67 P68 R70 N71 K72 K75 M76 L77 I81 R116 D137 R141 S151 F152 N153 N154 P155 P157 I158 E159
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hl3, PDBe:8hl3, PDBj:8hl3
PDBsum8hl3
PubMed37604686
UniProtP17198|RS7_SULAC Small ribosomal subunit protein uS7 (Gene Name=rps7)

[Back to BioLiP]