Structure of PDB 8hkz Chain AS7P

Receptor sequence

>8hkzAS7P (length=193) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

ENIEVSNLNVKVFGKWDTKVEVRDPSLKKYIDLMSIYLPHTGGRHEHRRF
GKSRIPIVERLINNLMRPGRNKGKKMLAYNIVKTTFDIIAVKTGQNPIQV
LVRAIENAAPREEVTRIMYGGIVYYVAVDVAPQRRVDLALRHLVTGASEA
SFNNPKPIEEALAEEIIAAANNDNKSVAIRKKEEIERIALSSR

3D structure

PDB

8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.

Chain

AS7P

Resolution

4.78 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS7P	T43 G44 G45 E48 R51 R62 N65 P70 R72 N73 G75 K76 K77 M78 L79 N82 I83 M120 R136 R143 S153 F154 N155 N156 P157 I160	T41 G42 G43 E46 R49 R60 N63 P68 R70 N71 G73 K74 K75 M76 L77 N80 I81 M118 R134 R141 S151 F152 N153 N154 P155 I158
BS02	rna	AS7P	M120 I124 V125 Y127 E186 R189 I190 S193	M118 I122 V123 Y125 E184 R187 I188 S191

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum	8hkz
PubMed	37604686
UniProt	P17198\|RS7_SULAC Small ribosomal subunit protein uS7 (Gene Name=rps7)

[Back to BioLiP]