Structure of PDB 8hl5 Chain AS5P

Receptor sequence

>8hl5AS5P (length=204) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

EDWKPRTKVGQLIKEGKINSMKELFERNLPIVEPEIVDVLLPKLRYDIVD
IGIVQKQTDAGELSRYKVLIVMGNMDGYISYGTGKAKQLRVAIQKAIRDA
KMRIIPVRRGCGSWECTCGESHSLPFIVSGKAGSVEVTLLPAPKGTGLVV
GSVLKTFLSLAGLKDVWSRTKGSTYTHENFIKAAYIALYNTYRFVTPVDW
GRMK

3D structure

PDB

8hl5 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

AS5P

Resolution

5.72 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	AS5P	V69 Q70 K71 Q72 T73 D74 A75 R80 K100 K146 G148 S149 T161 V164 V165 G166 S167 W182 S183 R184 T185 K186 S188 T189 Y190 T191 H192	V54 Q55 K56 Q57 T58 D59 A60 R65 K85 K131 G133 S134 T146 V149 V150 G151 S152 W167 S168 R169 T170 K171 S173 T174 Y175 T176 H177
BS02	UNK	AS5P	K37 E41	K22 E26
BS03	UNK	AS5P	Y207 R208	Y192 R193
BS04	UNK	AS5P	Y204 R208	Y189 R193

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hl5, PDBe:8hl5, PDBj:8hl5
PDBsum	8hl5
PubMed	37604686
UniProt	O05641\|RS5_SULAC Small ribosomal subunit protein uS5 (Gene Name=rps5)

[Back to BioLiP]