Structure of PDB 8hky Chain AS5P

Receptor sequence

>8hkyAS5P (length=204) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

EDWKPRTKVGQLIKEGKINSMKELFERNLPIVEPEIVDVLLPKLRYDIVD
IGIVQKQTDAGELSRYKVLIVMGNMDGYISYGTGKAKQLRVAIQKAIRDA
KMRIIPVRRGCGSWECTCGESHSLPFIVSGKAGSVEVTLLPAPKGTGLVV
GSVLKTFLSLAGLKDVWSRTKGSTYTHENFIKAAYIALYNTYRFVTPVDW
GRMK

3D structure

PDB

8hky Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

AS5P

Resolution

4.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	AS5P	Q70 K71 Q72 T73 D74 A75 K102 R113 K146 G148 S149 L155 G160 T161 V164 V165 G166 S167 W182 R184 K186 S188 Y190 T191 H192 N194	Q55 K56 Q57 T58 D59 A60 K87 R98 K131 G133 S134 L140 G145 T146 V149 V150 G151 S152 W167 R169 K171 S173 Y175 T176 H177 N179
BS02	UNK	AS5P	R217 M218	R202 M203
BS03	UNK	AS5P	E41 M218	E26 M203
BS04	UNK	AS5P	Y204 Y207	Y189 Y192

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hky, PDBe:8hky, PDBj:8hky
PDBsum	8hky
PubMed	37604686
UniProt	O05641\|RS5_SULAC Small ribosomal subunit protein uS5 (Gene Name=rps5)

[Back to BioLiP]