Structure of PDB 8wq2 Chain AS4P

Receptor sequence

>8wq2AS4P (length=166) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

DPRKSKKKWMGPSHPWIKINLGKEQILIGKYGLRNKKEIWIAQTMIRNFR
HQARSLLALPPAERNIREKQLIQKLYRMGILEKDNSTLDDILSLTEENYL
ERRLQTIVYKKGLARTIYQARQLITHGHIAISGRKVTSPGYVVLRGEEDL
IDYYPTSPFKQNPPSQ

3D structure

• PDB: 8wq2 Structural basis of translation inhibition by a valine tRNA-derived fragment
• Chain: AS4P
• Resolution: 4.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS4P	D3 P4 R5 K6 K8 K9 K10 M12 S15 H16 P17 W18 R36 N37 K38 K39 R49 N50 H53 Q72 K76 Q121 H128 R136 K137 V138 T139 S140 P141 P160 S167 Q168	D1 P2 R3 K4 K6 K7 K8 M10 S13 H14 P15 W16 R34 N35 K36 K37 R47 N48 H51 Q70 K74 Q119 H126 R134 K135 V136 T137 S138 P139 P158 S165 Q166

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0043226 organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8wq2, PDBe:8wq2, PDBj:8wq2
• PDBsum: 8wq2
• PubMed: 38599770
• UniProt: P39467|RS4_SULAC Small ribosomal subunit protein uS4 (Gene Name=rps4)