Structure of PDB 8wq4 Chain AS4E

Receptor sequence

>8wq4AS4E (length=240) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

VHITRFEAPWFLKVGKKEYKWIIRSRAGPHKIQESVPLAILLKYYLKAVD
TTREAKRIIFDGKVLVDGKVRRDYKYPVGLMDVVEIPSADLRVRIIPDNV
RYLTTINISREDAKYKFVRIMNKTTLKSGVLQLNLEDGRNILLKGEELSQ
YNLPTLTTLKIELPEQKITTAYTIKEGVYAMIIGGRNAGLHGKISKIQLA
KYKRIKYSLVTLEGKDGSTFQTNLINVMAIGENEADSNLG

3D structure

PDB

8wq4 Structural basis of translation inhibition by a valine tRNA-derived fragment

Chain

AS4E

Resolution

4.53 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS4E	H2 F6 K16 K17 E18 Y19 W21 I23 R26 A27 G28 P29 K31 T51 T52 R53 K56 R57 F60 K69 Y102 K123 T125 K127 S128 D137 G138 R139 G185 R186 N187 R204 I205 Q221	H2 F6 K16 K17 E18 Y19 W21 I23 R26 A27 G28 P29 K31 T51 T52 R53 K56 R57 F60 K69 Y102 K123 T125 K127 S128 D137 G138 R139 G185 R186 N187 R204 I205 Q221

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8wq4, PDBe:8wq4, PDBj:8wq4
PDBsum	8wq4
PubMed	38599770
UniProt	O05634\|RS4E_SULAC Small ribosomal subunit protein eS4 (Gene Name=rps4e)

[Back to BioLiP]