Structure of PDB 8wq2 Chain AS4E

Receptor sequence

>8wq2AS4E (length=240) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

VHITRFEAPWFLKVGKKEYKWIIRSRAGPHKIQESVPLAILLKYYLKAVD
TTREAKRIIFDGKVLVDGKVRRDYKYPVGLMDVVEIPSADLRVRIIPDNV
RYLTTINISREDAKYKFVRIMNKTTLKSGVLQLNLEDGRNILLKGEELSQ
YNLPTLTTLKIELPEQKITTAYTIKEGVYAMIIGGRNAGLHGKISKIQLA
KYKRIKYSLVTLEGKDGSTFQTNLINVMAIGENEADSNLG

3D structure

PDB

8wq2 Structural basis of translation inhibition by a valine tRNA-derived fragment

Chain

AS4E

Resolution

4.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS4E	V1 H2 F6 E7 K16 K17 Y19 W21 I22 I23 R26 A27 G28 P29 H30 K31 I32 T51 T52 R53 F60 R71 Y102 K123 T125 L126 K127 S128 G129 R139 N140 T155 Q166 G185 R186 N187 K201 Y202 R204 Q221 T222 N223	V1 H2 F6 E7 K16 K17 Y19 W21 I22 I23 R26 A27 G28 P29 H30 K31 I32 T51 T52 R53 F60 R71 Y102 K123 T125 L126 K127 S128 G129 R139 N140 T155 Q166 G185 R186 N187 K201 Y202 R204 Q221 T222 N223

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8wq2, PDBe:8wq2, PDBj:8wq2
PDBsum	8wq2
PubMed	38599770
UniProt	O05634\|RS4E_SULAC Small ribosomal subunit protein eS4 (Gene Name=rps4e)

[Back to BioLiP]