Structure of PDB 8wkp Chain AS2P

Receptor sequence
>8wkpAS2P (length=196) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
ELLVPLDTYLSAGVHIGTHTCTRYMERFIYRVRPEGLYVLDVRKIDERLR
VAAKFISRFRPEAVLTVASRPYAFTPVQKFSEVVRGKEISGRFPPGTLTN
PYLDNYIEPEVLIVTDPRTDLQAIKEASKVGIPIVAFTDTDARVDFIDVI
IPANNKGRKSLALLYWVLARQILRERKEIPLDGDIPLRVEDFETRL
3D structure
PDB8wkp Structural basis of translation inhibition by a valine tRNA-derived fragment
ChainAS2P
Resolution4.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS2P H46 T47 C48 T49 R50 Y51 P61 E62 G63 R119 P121 P122 G123 T126 N127 L130 D131 R170 H19 T20 C21 T22 R23 Y24 P34 E35 G36 R92 P94 P95 G96 T99 N100 L103 D104 R143
BS02 UNK AS2P S155 V157 G158 S128 V130 G131
BS03 UNK AS2P D172 F173 D145 F146
BS04 UNK AS2P R54 V171 R27 V144
BS05 UNK AS2P F82 R85 F55 R58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wkp, PDBe:8wkp, PDBj:8wkp
PDBsum8wkp
PubMed38599770
UniProtP39478|RS2_SULAC Small ribosomal subunit protein uS2 (Gene Name=rps2)

[Back to BioLiP]