Structure of PDB 7tor Chain AS26

Receptor sequence

>7torAS26 (length=101) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R

3D structure

PDB

7tor Ribosome inhibition by C9ORF72-ALS/FTD-associated poly-PR and poly-GR proteins revealed by cryo-EM.

Chain

AS26

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS26	T2 K3 K4 R5 R6 N7 N8 R10 A11 K12 K13 R15 H17 Q19 K32 K34 K37 K38 F39 K70 V75 I79 K82 R85 N86 R87 S88 R89 R92 K93 R95 T96 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 R9 A10 K11 K12 R14 H16 Q18 K31 K33 K36 K37 F38 K69 V74 I78 K81 R84 N85 R86 S87 R88 R91 K92 R94 T95 P96 P97 R99
BS02	ZN	AS26	C23 C74 C77	C22 C73 C76

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links

PDB	RCSB:7tor, PDBe:7tor, PDBj:7tor
PDBsum	7tor
PubMed	35589706
UniProt	G1TFE8\|RS26_RABIT Small ribosomal subunit protein eS26 (Gene Name=RPS26)