Structure of PDB 9bdp Chain AS19

Receptor sequence

>9bdpAS19 (length=141) Species: 9986 (Oryctolagus cuniculus)

GVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENW
FYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARR
VLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAAKK

3D structure

• PDB: 9bdp Structural mechanism of angiogenin activation by the ribosome.
• Chain: AS19
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS19	G3 K7 Q11 Q12 V15 W33 L39 K41 K43 E44 P47 Y48 R62 H63 R67 G71 V72 G73 S74 K77 I78 Y79 R82 R84 G86 V87 M88 P89 S90 H91 F92 S96 K97 S98 R101 R102 Q105 R121 P125 Q128 R129 D132 R133	G1 K5 Q9 Q10 V13 W31 L37 K39 K41 E42 P45 Y46 R60 H61 R65 G69 V70 G71 S72 K75 I76 Y77 R80 R82 G84 V85 M86 P87 S88 H89 F90 S94 K95 S96 R99 R100 Q103 R119 P123 Q126 R127 D130 R131

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:9bdp, PDBe:9bdp, PDBj:9bdp
• PDBsum: 9bdp
• PubMed: 38718836
• UniProt: G1TN62|RS19_RABIT Small ribosomal subunit protein eS19 (Gene Name=RPS19)