Structure of PDB 6n1d Chain AS18

Receptor sequence
>6n1dAS18 (length=70) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
KAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAK
TIKRARILGLLPFTEKLVRK
3D structure
PDB6n1d Spontaneous ribosomal translocation of mRNA and tRNAs into a chimeric hybrid state.
ChainAS18
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS18 K49 I50 R53 R54 A60 K61 Q63 R64 K71 R72 R74 I75 F81 K31 I32 R35 R36 A42 K43 Q45 R46 K53 R54 R56 I57 F63
BS02 MG AS18 D30 L31 D12 L13
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n1d, PDBe:6n1d, PDBj:6n1d
PDBsum6n1d
PubMed30936299
UniProtP62659|RS18_THET2 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]