Structure of PDB 4xej Chain AS16

Receptor sequence

>4xejAS16 (length=83) Species: 262724 (Thermus thermophilus HB27)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQE

3D structure

• PDB: 4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
• Chain: AS16
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS16	M1 V2 K3 R5 L6 R8 G10 S11 K12 H13 H16 Y17 R18 A24 R25 K27 R28 G30 K31 Y32 I33 K35 Y38 P41 R42 K43 T44 V62 G63 Q65 T67 D68 T69 R72 R75 R81	M1 V2 K3 R5 L6 R8 G10 S11 K12 H13 H16 Y17 R18 A24 R25 K27 R28 G30 K31 Y32 I33 K35 Y38 P41 R42 K43 T44 V62 G63 Q65 T67 D68 T69 R72 R75 R81

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4xej, PDBe:4xej, PDBj:4xej
• PDBsum: 4xej
• PubMed: 25652826
• UniProt: P62238|RS16_THET2 Small ribosomal subunit protein bS16 (Gene Name=rpsP)